KEGG   Rhodococcus jostii: RHA1_ro08059
Entry
RHA1_ro08059      CDS       T00382                                 

Gene name
bphAb
Definition
(GenBank) biphenyl 2,3-dioxygenase beta subunit
  KO
K15750  biphenyl 2,3-dioxygenase subunit beta [EC:1.14.12.18]
Organism
rha  Rhodococcus jostii
Pathway
rha00621  Dioxin degradation
rha01100  Metabolic pathways
rha01120  Microbial metabolism in diverse environments
rha01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    RHA1_ro08059 (bphAb)
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.18  biphenyl 2,3-dioxygenase
     RHA1_ro08059 (bphAb)
SSDB
Motif
Pfam: Ring_hydroxyl_B
Other DBs
NCBI-ProteinID: ABG99106
UniProt: Q53123
LinkDB
Structure
PDB: 
1ULI 1ULJ

Position
pRHL1:complement(55469..56032)
AA seq 187 aa
MIDAESPTTAFRTKPAPVDPSLQHEIEQFYYWEAKLLNDRRFQEWFDLLAEDIHYFMPIR
TTRIMRETAQEYSGAREYAHFDDNAQMMRGRLRKITSDVSWSENPASRTRHVISNVMIVD
GEKPGEYHVSSVFIVYRNRLERQLDIFAGERKDILRRTGSEAGFELAKRTILIDQSTILS
NNLSFFF
NT seq 564 nt   +upstreamnt  +downstreamnt
atgattgacgccgaatcgccaaccacggcatttcgaacaaaacccgcaccagtagacccc
agcctgcagcacgagatcgagcagttctactactgggaggcgaaacttctcaatgaccgc
cgcttccaagaatggttcgatctgttggcagaagatattcattacttcatgccgatccga
accacgcggatcatgcgggaaactgcacaggagtattccggtgcccgtgaatacgcacat
ttcgatgacaatgcgcagatgatgcgagggcgcctgcgcaagatcacttcagatgtgagc
tggtcggagaaccctgcctcgcgcacgcggcatgtgatttccaacgtcatgatcgtcgac
ggtgagaaacctggtgaataccacgtctcgagcgtcttcatcgtgtacagaaatcggctc
gagcggcagctcgatattttcgctggggagcggaaggacattctgcgtcggactggtagc
gaagcgggtttcgaactcgcgaagcgaacgatcctgatcgaccagagcacaattctctcc
aacaacctcagcttcttcttctag

DBGET integrated database retrieval system