Rodentibacter haemolyticus: IHV77_01445 Help Entry IHV77_01445       CDS       T07810                                  Name (GenBank) DinI-like family protein   KO K12149   DNA-damage-inducible protein I Organism rhae  Rodentibacter haemolyticus Brite KEGG Orthology (KO) [BR:rhae00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:rhae03400]     IHV77_01445 DNA repair and recombination proteins [BR:rhae03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     IHV77_01445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI DUF7320 NIR_SIR_ferr Motif Other DBs NCBI-ProteinID:  QPB43635 LinkDB All DBs Position 293774..293998 Genome browser AA seq 74 aa AA seqDB search MQQKVITRLEEILPKRIAEKFNDVQVRIRTSSSQGFDISRFDKGDKKKILEYLEEIWNDD SLLDGMMNKSNQID NT seq 225 nt NT seq  +upstreamnt  +downstreamnt ctgcagcaaaaagttatcaccaggttggaagaaatattgcctaaacgtattgctgaaaaa tttaatgatgttcaagtaagaatcagaacatcgagctcacaaggattcgatatttcaaga tttgataaaggcgataagaaaaaaattttagaatatcttgaagaaatttggaatgatgat tcattgcttgacggaatgatgaataaaagtaaccaaatagattaa

DBGET integrated database retrieval system