Rodentibacter haemolyticus: IHV77_02895 Help Entry IHV77_02895       CDS       T07810                                  Name (GenBank) DinI-like family protein   KO K12149   DNA-damage-inducible protein I Organism rhae  Rodentibacter haemolyticus Brite KEGG Orthology (KO) [BR:rhae00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:rhae03400]     IHV77_02895 DNA repair and recombination proteins [BR:rhae03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     IHV77_02895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI CopK NIR_SIR_ferr Motif Other DBs NCBI-ProteinID:  QPB43080 LinkDB All DBs Position 573706..573966 Genome browser AA seq 86 aa AA seqDB search MKKIDIRFTKERDSKKIAMQQKAIERLEEILPKRIAEKFSDVEVRIRTSSSQGFDVSGFD KDDKTKFLEYLEEIWNDDSLLDGIDE NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaaatagacattcgttttacaaaagaacgtgatagcaaaaaaatagctatgcag caaaaagctattgaaaggctagaagaaatattgccaaaacgtattgctgaaaaatttagt gatgttgaagtcagaatcagaacatcaagctcacaaggatttgatgtttcggggtttgat aaagatgacaagacaaaatttttagaataccttgaagaaatttggaatgatgattcattg cttgatggaatagatgaataa

DBGET integrated database retrieval system