Ruania halotolerans: LQF10_09210 Help Entry LQF10_09210       CDS       T08257                                  Name (GenBank) chorismate mutase   KO K04782   isochorismate pyruvate lyase [EC:4.2.99.21] Organism rhal  Ruania halotolerans Pathway rhal01053   Biosynthesis of siderophore group nonribosomal peptides rhal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhal00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01053 Biosynthesis of siderophore group nonribosomal peptides     LQF10_09210 Enzymes [BR:rhal01000]  4. Lyases   4.2  Carbon-oxygen lyases    4.2.99  Other carbon-oxygen lyases     4.2.99.21  isochorismate lyase      LQF10_09210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  UFU08249 LinkDB All DBs Position 2083883..2084167 Genome browser AA seq 94 aa AA seqDB search MTAADPSLATVRAEIDTLDSQIIDRIAKRQVQVIRAGVLKRGQAVETVHAPTRVEEVIDK VRTQAEFTGASPDVVEAAYRAMIGAFIALEVDVH NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaccgccgcagacccttcactcgcaactgtccgagccgagatcgacacgctggacagc cagatcattgatcggattgcgaagcggcaagtccaagtcattcgagcaggcgtactgaag cgcggtcaggcggttgaaacggtgcatgcgccaacgcgcgtagaggaagtgatcgacaag gtccggacacaggcggaatttactggggcctcacccgatgtcgtcgaggcggcataccga gccatgattggcgccttcatcgcactagaggtcgacgtccattag

DBGET integrated database retrieval system