Ruania halotolerans: LQF10_14070 Help Entry LQF10_14070       CDS       T08257                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism rhal  Ruania halotolerans Brite KEGG Orthology (KO) [BR:rhal00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     LQF10_14070 Enzymes [BR:rhal01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      LQF10_14070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Thioredoxin_2 GST_N_3 Thioredoxin DUF3088 Motif Other DBs NCBI-ProteinID:  UFU08427 LinkDB All DBs Position 3140557..3140781 Genome browser AA seq 74 aa AA seqDB search MYSTTWCGYCRRLKGQLDGAGIPFTEVNIEEVPDAAAFVEQVNGGNQTVPTVVFPDGSAA TNPSLAQVRERLLA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgtacagcaccacctggtgcgggtactgccgccggctcaagggccagctggacggcgcc ggaatcccgttcaccgaggtcaacatcgaagaggtcccggacgctgcagcattcgtggag caggtcaatggcggcaaccagaccgtgcccacggtggtattcccggacggatccgcggcg acgaacccgtcgttggcgcaggtccgggagcgcctcctcgcctga

DBGET integrated database retrieval system