Rhodococcus sp. B7740: NY08_3261 Help Entry NY08_3261         CDS       T03776                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism rhb  Rhodococcus sp. B7740 Pathway rhb00998   Biosynthesis of various antibiotics rhb01100   Metabolic pathways rhb01110   Biosynthesis of secondary metabolites Module rhb_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) Brite KEGG Orthology (KO) [BR:rhb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NY08_3261    00074 Mycolic acid biosynthesis     NY08_3261   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NY08_3261 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF5905 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AJW41271 LinkDB All DBs Position complement(3354071..3354334) Genome browser AA seq 87 aa AA seqDB search MSNDSITYVPEYLEDIREIVADILEVETDEVGETTHFAEELDADSLRAIEILSQLEKKFK IDIPQTELPRMENLSAVYAVVAERAGW NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagcaacgacagcatcacctacgtacccgagtacctggaagacattcgcgagatcgtc gccgacatcctcgaggtcgagaccgacgaggtcggcgagacaacacatttcgccgaggag ctcgacgccgattcgctgcgtgccatcgagattctctcgcagctcgagaagaagttcaag atcgacatcccacagaccgaactgccgcgaatggagaacctgtccgcggtgtacgccgtc gtcgccgagcgcgcaggctggtaa

DBGET integrated database retrieval system