Rhodococcus sp. BH4: A0W34_06135 Help Entry A0W34_06135       CDS       T10984                                  Name (GenBank) preprotein translocase   KO K03116   sec-independent protein translocase protein TatA Organism rhbh  Rhodococcus sp. BH4 Pathway rhbh03060   Protein export rhbh03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:rhbh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     A0W34_06135  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     A0W34_06135  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:rhbh02044]     A0W34_06135 Secretion system [BR:rhbh02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    A0W34_06135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ARE32957 LinkDB All DBs Position 1331278..1331454 Genome browser AA seq 58 aa AA seqDB search MGALSPTHWAIVAVVLVVLFGSKKLPDAARGLGRSMRILKSEVGELQSDTDLALEQRD NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atgggcgcgctcagcccgactcactgggcgatcgtcgcagtagtgctcgtggtgctgttc ggttcgaagaagctgcccgacgcggcccggggcctcggcaggtcgatgcggatcctgaag tccgaagtcggtgaactgcagtcggatacggacctcgcgttggagcagcgagactga

DBGET integrated database retrieval system