Rhodovulum sp. P5: RGUI_0325 Help Entry RGUI_0325         CDS       T04813                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism rhc  Rhodovulum sp. P5 Pathway rhc01100   Metabolic pathways rhc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RGUI_0325    00074 Mycolic acid biosynthesis     RGUI_0325   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RGUI_0325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Delta_lysin Motif Other DBs NCBI-ProteinID:  ARE38466 UniProt:  A0A1V0PQR7 LinkDB All DBs Position complement(212888..213121) Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVEEDKVTDTASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFIKDAA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgctgatcgcgttaagaagatcgttgtcgagcaccttggggtcgaggaa gacaaggtgacggatactgcatcgttcatcgatgatctgggcgccgacagccttgatacc gtcgaactggtcatggctttcgaagaagaattcggcatcgagattccggacgatgcggcc gagacgatccagaccttcggcgacgcggtgaagttcatcaaggacgccgcctga

DBGET integrated database retrieval system