Rhodovulum sp. P5: RGUI_2026 Help Entry RGUI_2026         CDS       T04813                                  Name (GenBank) hypothetical protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism rhc  Rhodovulum sp. P5 Pathway rhc00190   Oxidative phosphorylation rhc01100   Metabolic pathways rhc02020   Two-component system Module rhc_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:rhc00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     RGUI_2026  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     RGUI_2026 Enzymes [BR:rhc01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      RGUI_2026 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ARE40167 UniProt:  A0A1V0PW65 LinkDB All DBs Position 1930542..1930667 Genome browser AA seq 41 aa AA seqDB search MWYFAWILGLPLAALLAVVNAMWLEMHCDNEIIEDGPMSRK NT seq 126 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcctggatcctcgggcttcccctcgccgcccttctggccgtggtcaac gcgatgtggcttgagatgcattgcgacaacgagatcatcgaagacgggccgatgtcgcgc aagtag

DBGET integrated database retrieval system