Rhodovulum sp. P5: RGUI_2500
Help
Entry
RGUI_2500 CDS
T04813
Name
(GenBank) ABC transporter, transmembrane ATP-binding protein
KO
K18893
ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
rhc
Rhodovulum sp. P5
Pathway
rhc02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
rhc00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
RGUI_2500
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
rhc02000
]
RGUI_2500
Transporters [BR:
rhc02000
]
ABC transporters, eukaryotic type
ABCB (MDR/TAP) subfamily
ABCB-BAC subgroup
RGUI_2500
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
ABC_membrane
SMC_N
AAA_16
AAA_22
MMR_HSR1
AAA_30
RsgA_GTPase
AAA_21
AAA_29
MeaB
DUF87
DUF815
MobB
DUF3267
Motif
Other DBs
NCBI-ProteinID:
ARE40641
LinkDB
All DBs
Position
2403461..2405302
Genome browser
AA seq
613 aa
AA seq
DB search
MFRFFESLVDPYRPYADSDTPPRRLAPFLWGYAKPFWKVFVIAIVLAILSAAVEVWLINV
LGNIVDLLSDGTPQQVWQAHGTTMIALGLFILIVRPAIQALDAAVLNNGIMPNFGTMIRW
RAHAHVLRQSVGWFENDFAGRIANRIMQTPPAAGEAVFQVFDAISYALAYVVGAAIFLGQ
ADPRLAIPLLVWLLLYAILVRWTIKRVGPASKAASDARSAVTGRVVDAYTNIHAVKLFAH
HDRELAYAKEAIEDTRRTFAAEMRIFTKMDFALTALNGFLIVGVVGWAIGLWMQGMASVG
VVAAATALTLRLNAMTGWIMWSLSSFFRSLGVVAEGMETIAQPITLVDAPDARAMDFREG
RIEIKALTHHYGRGSGGLEGIDLTLEPGEKVGLVGRSGAGKSTLVKLLLRFYDAEGGRIL
IDGQDVAHVTQESLRRHIGMVSQEATLMHRSVRDNILYGRPEASEDEMIAAAKRAEAHDF
ILDLADSDGRRGYDARVGERGVKLSGGQRQRIALARVILKDAPILVLDEATSALDSEVEA
AIQETLYGVMEGKTVIAIAHRLSTIAHMDRIVVLDDGRVVEDGSHGQLLAHGGLYARFWA
RQSGGFIGTEAAE
NT seq
1842 nt
NT seq
+upstream
nt +downstream
nt
gtgttccgattcttcgaatcccttgtcgatccgtacaggccgtatgcggacagcgatacg
ccgccccggcggttggcgccgttcctgtggggctatgccaaacccttctggaaggtgttc
gtcatcgcgatcgtgctggccatcctgtcggcagcggtcgaggtctggctgatcaacgtg
ctggggaacatcgtcgatctgttgtccgatggaacgccgcaacaggtctggcaggcgcat
gggacgacgatgatcgcgctggggctgttcatcctgatcgtgcggccggcaattcaggcg
ctggatgcggcggtcctgaacaacgggatcatgccgaatttcggcacgatgatccggtgg
cgcgcccatgcccatgtgctgcgccagtccgtcggctggttcgagaacgactttgccggg
cgcattgccaatcgcatcatgcagaccccgcccgccgcgggcgaggcggtgtttcaggtc
ttcgacgcgatcagctatgcgctggcctatgtcgtcggcgccgcgatcttccttgggcag
gccgatccccggctggcgattccgctgctggtctggctgctgctctacgccattctggtg
cgctggacgatcaagcgggtgggaccggcgtccaaggcggcgtcggatgcgcgcagcgcc
gtgacgggtcgggtggtggatgcctataccaacattcatgcggtcaagcttttcgcccat
cacgaccgggaattggcctatgcgaaggaggccatcgaagacacgcgccggacctttgcc
gccgagatgcggattttcaccaagatggattttgccctgaccgcactgaacggcttcctg
atcgtgggtgtggtcggttgggcaatcgggctttggatgcaggggatggcaagcgtgggc
gtcgtggcggcggccaccgcgctgacgctgcgcctgaacgcgatgaccggctggatcatg
tggtcgctgtccagcttcttccgctcgctcggcgtcgtggccgaggggatggagacgatc
gcgcagccgatcacgctggtcgatgcgcccgatgcccgcgcgatggactttcgcgagggc
cggatcgagatcaaggcgctgacccatcactacgggcgcggcagcggcgggctggagggg
atcgacctgaccctggagcccggtgagaaggtcgggctggtcgggcggtccggtgcgggg
aagtcgacattggtgaagctgctgttgcggttctacgacgccgagggcgggcgtatcctg
atcgacgggcaggacgtggcccatgtcacgcaggaatccctgcgccgccatatcggcatg
gtcagtcaggaggcgacgctgatgcaccgctccgtccgcgacaacatcctttatggccga
cccgaggcgagtgaggacgagatgatcgccgcagcaaagcgggcggaggcgcatgacttc
atcctcgatcttgcagacagcgacggtcggcgcgggtacgatgcgcgcgtcggcgaacgc
ggcgtgaaactctcgggtgggcagcggcagcggatcgcactggcccgcgtgatcctgaaa
gacgccccgatccttgtgctggacgaggcgacctcggcgctggattccgaagtcgaggcg
gcgattcaggaaacgctctacggggtgatggagggcaagacggtgatcgccatcgcgcac
cggctgtcgaccatcgcgcatatggaccggatcgtggtgctggatgacggccgcgtcgtc
gaagacggcagccatgggcagttgctggcgcatggcgggctttatgcccggttctgggcg
cggcaatcgggcggcttcatcgggacggaggcggcggagtga
DBGET
integrated database retrieval system