Rhodovulum sp. P5: RGUI_2744 Help Entry RGUI_2744         CDS       T04813                                  Name (GenBank) DNA-binding protein HBsu   KO K03530   DNA-binding protein HU-beta Organism rhc  Rhodovulum sp. P5 Brite KEGG Orthology (KO) [BR:rhc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rhc03032]     RGUI_2744    03036 Chromosome and associated proteins [BR:rhc03036]     RGUI_2744    03400 DNA repair and recombination proteins [BR:rhc03400]     RGUI_2744 DNA replication proteins [BR:rhc03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     RGUI_2744 Chromosome and associated proteins [BR:rhc03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     RGUI_2744 DNA repair and recombination proteins [BR:rhc03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       RGUI_2744 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 DUF2267 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  ARE40885 UniProt:  A0A1V0PXM9 LinkDB All DBs Position 2671133..2671402 Genome browser AA seq 89 aa AA seqDB search MGTVNKSDMIREVAEATGHTAAAAQAAVDAFLAAVKTRAEAGDTISLRGFGIFKVRARPA RMGRNIRTGEPMELPESRKLTFKAAKTKA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgggcactgtcaacaaatccgacatgatccgcgaagtggccgaggccacgggccatacg gccgcagccgcgcaggcggccgtggacgccttcctggccgccgtgaaaacacgcgcggag gcgggagacacgatcagcctgcgcggcttcggcatcttcaaggtccgggcccggccggcc cggatgggccgcaacattcggaccggtgagccgatggagctgccggaatcccgcaaactg accttcaaggccgcgaaaacgaaggcctga

DBGET integrated database retrieval system