Rhodanobacter denitrificans: R2APBS1_1089 Help Entry R2APBS1_1089      CDS       T02495                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhd  Rhodanobacter denitrificans Pathway rhd01100   Metabolic pathways rhd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     R2APBS1_1089    00074 Mycolic acid biosynthesis     R2APBS1_1089   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     R2APBS1_1089 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  AGG88244 UniProt:  I4WNU6 LinkDB All DBs Position complement(1196532..1196804) Genome browser AA seq 90 aa AA seqDB search MTATIQQQVFEIIAKQAKIEVATIRPESTLKDLGVASLEAIEMIFDIEEHFNINFPDQQG ANFDTDTAQSLVDAVQKALDDKAATGEGSK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaccgcaacgatccagcagcaggtattcgagatcatcgccaagcaggccaagatcgag gtggcgacgatcaggcccgaatccaccctgaaggacctgggcgtcgcctcgctggaagcg atcgagatgatcttcgacatcgaggaacacttcaacatcaacttccccgaccagcagggc gccaacttcgacaccgacaccgcgcagagcctggtcgacgcggtgcagaaagcgctggac gacaaggccgccacgggcgaaggaagcaagtga

DBGET integrated database retrieval system