Rheinheimera sp. F8: ATY27_09665 Help Entry ATY27_09665       CDS       T09854                                  Name (GenBank) molecular chaperone GroES   KO K04078   chaperonin GroES Organism rhei  Rheinheimera sp. F8 Brite KEGG Orthology (KO) [BR:rhei00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:rhei03110]     ATY27_09665    03029 Mitochondrial biogenesis [BR:rhei03029]     ATY27_09665 Chaperones and folding catalysts [BR:rhei03110]  Heat shock proteins   HSP10    ATY27_09665 Mitochondrial biogenesis [BR:rhei03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     ATY27_09665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  ALZ76009 LinkDB All DBs Position 2193501..2193791 Genome browser AA seq 96 aa AA seqDB search MNIRPLHDRVIIKRLEAESKSAGGIVLTGASAEKSTRGEVVAVGLGRILENGSVRPLEVK VGDKVIFGAYVERSEKIDGQEYVITKEDNILGIITE NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaatattcgtccattacatgatcgcgtcatcatcaagcgtctggaagccgaaagcaaa tcagccggtggcattgtattgactggcgcctcagctgagaagtcaacccgcggtgaagtt gttgcagtgggcttgggccgtattctggaaaacggcagcgttcgtccgctggaagtcaaa gtgggtgacaaagtaatttttggtgcttacgtcgagcgttctgagaaaattgacggtcag gaatacgtgatcactaaagaagacaacatccttggcatcatcactgaataa

DBGET integrated database retrieval system