KEGG   Rheinheimera sp. F8: ATY27_15470
Entry
ATY27_15470       CDS       T09854                                 
Symbol
sirA
Name
(GenBank) two-component system response regulator
  KO
K07689  two-component system, NarL family, invasion response regulator UvrY
Organism
rhei  Rheinheimera sp. F8
Pathway
rhei02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhei00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ATY27_15470 (sirA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rhei02022]
    ATY27_15470 (sirA)
Two-component system [BR:rhei02022]
 NarL family
  BarA-UvrY (central carbon metabolism)
   ATY27_15470 (sirA)
SSDB
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_23 HTH_7 Sigma70_r4 HTH_29 Phage_terminase HTH_38 HTH_11 HTH_24 HTH_28 ArsR
Other DBs
NCBI-ProteinID: ALZ77015
LinkDB
Position
complement(3490012..3490665)
AA seq 217 aa
MINVLIVDDHELVRTGISRILQEERGIRVVADLNSGEAAVQYCRNEAAGQLPPDVVLMDM
NMPGIGGMNATKRILHYCPDIRVLALSVSCEEPVPTKVMQMGASGFISKNAAPSEMITAI
KRVADGHRYISDEVAQKMAFSKIQSNSNNPFDELSDREMQIMLMITQGEKVNDIADKLNV
SAKTVNSYRYRMFEKLAISGDVELTHLAIRHGMINIA
NT seq 654 nt   +upstreamnt  +downstreamnt
ttgattaacgttctgatagtggatgatcatgaattggtccggaccgggatcagcaggatt
ttacaggaagagcgtggcattcgggttgtcgccgatttgaactccggtgaagctgccgtg
caatattgccgcaatgaagccgccggccaactgccgcccgacgtggtgctgatggatatg
aatatgccggggatcggtggtatgaatgccaccaaacgcatcctgcattattgcccggat
atccgtgtgctggccttgtcggtgtcctgtgaagaacctgtgccaaccaaagtgatgcaa
atgggcgcttctggttttatctccaaaaatgcagcgccgtctgagatgatcaccgccatc
aagcgcgttgccgatggccatcgttatatctctgatgaagtcgcacagaaaatggctttc
agtaaaattcaatccaatagtaacaatccgtttgacgaattgtctgaccgcgaaatgcag
atcatgctgatgattacgcaaggcgaaaaagtgaatgatattgccgacaaactgaatgtc
agtgccaaaacggtcaattcataccgttatcgcatgtttgaaaagctggccattagcggt
gatgttgaactgacccatctggcgatccgccatggcatgatcaatattgcctga

DBGET integrated database retrieval system