Rodentibacter caecimuris: FEE42_07195 Help Entry FEE42_07195       CDS       T06473                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhey  Rodentibacter caecimuris Pathway rhey00998   Biosynthesis of various antibiotics rhey01100   Metabolic pathways rhey01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhey00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FEE42_07195    00074 Mycolic acid biosynthesis     FEE42_07195   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FEE42_07195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QIA77161 LinkDB All DBs Position 1433017..1433304 Genome browser AA seq 95 aa AA seqDB search MAYLFTLESNLLELELKKLILQESEKEELEPDEISDDEPLFGGQSRIQLDSLDALQIAVA LQAHFKVRLQGDRMVRKHMMNVRDLAAFIREQHQK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcttatctttttactcttgaatcaaatttgcttgaattagagttaaaaaaactcatt ttacaggaatcggaaaaagaggaacttgaacctgatgaaatttctgatgacgaacctctt tttggcgggcaaagccgtattcagttagattcccttgatgcgttacaaattgcggtggca ttacaggcacattttaaagtacgtttacagggtgaccgaatggtgcgtaagcatatgatg aacgtgcgcgatcttgcggcttttattcgtgaacaacaccaaaaatga

DBGET integrated database retrieval system