Rodentibacter caecimuris: FEE42_07280 Help Entry FEE42_07280       CDS       T06473                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhey  Rodentibacter caecimuris Pathway rhey00998   Biosynthesis of various antibiotics rhey01100   Metabolic pathways rhey01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhey00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FEE42_07280    00074 Mycolic acid biosynthesis     FEE42_07280   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FEE42_07280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 DUF2482 DUF1493 Motif Other DBs NCBI-ProteinID:  QIA77177 LinkDB All DBs Position complement(1448903..1449151) Genome browser AA seq 82 aa AA seqDB search MTEQEIRDLLSEALQSLFEIEPERIKPETNLYEELEIDSIDAIDLIDHIKRKTGHKLQAE DFRNVRTVDDVVQAVLKQQNSV NT seq 249 nt NT seq  +upstreamnt  +downstreamnt gtgactgaacaagaaatcagagatttactcagcgaagcacttcaatcgctgtttgaaatt gaaccggagcgaattaaaccggaaaccaatctttatgaagagttagagattgacagcatt gatgcgattgacttgattgatcatatcaaacgaaaaacggggcataaattacaggcagaa gattttcgcaatgtgcgtaccgtagacgatgtggtgcaagcagtgttaaaacaacaaaac tctgtgtaa

DBGET integrated database retrieval system