Rodentibacter caecimuris: FEE42_10865 Help Entry FEE42_10865       CDS       T06473                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhey  Rodentibacter caecimuris Pathway rhey00998   Biosynthesis of various antibiotics rhey01100   Metabolic pathways rhey01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhey00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FEE42_10865 (acpP)    00074 Mycolic acid biosynthesis     FEE42_10865 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FEE42_10865 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QIA77796 LinkDB All DBs Position 2194326..2194556 Genome browser AA seq 76 aa AA seqDB search MSIEERVKKIIVEQLGVKEEDVKPEASFVEDLGADSLDTVELVMALEEEFDIEIPDEEAE KITTVQSAIDYVQNNQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagcattgaagaacgcgtaaaaaaaatcatcgttgaacaattaggtgttaaagaagaa gatgtgaaacctgaagcttctttcgttgaagatttaggtgcggactctttagatacagtt gaattggttatggctttggaagaggaatttgatattgaaattccggatgaagaagcggaa aaaatcacaactgttcaatctgcgattgactacgttcaaaataatcaataa

DBGET integrated database retrieval system