Rhodoferax sediminis CHu59-6-5: EUB48_17485 Help Entry EUB48_17485       CDS       T06165                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhf  Rhodoferax sediminis CHu59-6-5 Pathway rhf01100   Metabolic pathways rhf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EUB48_17485    00074 Mycolic acid biosynthesis     EUB48_17485   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EUB48_17485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QDL38881 UniProt:  A0A515DEN7 LinkDB All DBs Position complement(3625607..3625846) Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVVSEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYATSHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaaaaaaatcatcgccgagcaactcggtgtggaagaa tctcaagtcgtcagcgagaaggcctttgtggccgacctcggcgccgactccctggacacg gtggaactggtgatggcactggaagacgagttcggcattgaaattccggacgaagacgcc gagaagatcaccaccgttcaaaacgcgattgattacgccaccagccaccagaaggcttaa

DBGET integrated database retrieval system