Rhodoferax aquaticus: EXZ61_05970 Help Entry EXZ61_05970       CDS       T06176                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism rhg  Rhodoferax aquaticus Brite KEGG Orthology (KO) [BR:rhg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:rhg03110]     EXZ61_05970 (grxC) Chaperones and folding catalysts [BR:rhg03110]  Protein folding catalysts   Protein disulfide isomerase    EXZ61_05970 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like DSBA Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  QDL53757 UniProt:  A0A515EM71 LinkDB All DBs Position 1271193..1271453 Genome browser AA seq 86 aa AA seqDB search MQAVKMYTTAVCPYCVQAKRILKSKGVDHIEEIRIDADPAQRMKMMEVTGRRTVPQIFIG DTHVGGCDDLMALDSQGGLVPLLQSA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcaagccgtcaagatgtacaccacagccgtttgcccctactgcgtgcaagccaagcgc attctcaaatccaagggcgtagaccacatcgaggaaattcgcatcgatgcggaccccgcc cagcgcatgaaaatgatggaagtgacgggtcggcgcaccgtgccacagatttttattggc gacacccatgtaggtgggtgcgatgacctaatggccttggacagccaaggcggcttggtg cctctgcttcaaagcgcttga

DBGET integrated database retrieval system