Rhodoferax aquaticus: EXZ61_15300 Help Entry EXZ61_15300       CDS       T06176                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhg  Rhodoferax aquaticus Pathway rhg01100   Metabolic pathways rhg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EXZ61_15300    00074 Mycolic acid biosynthesis     EXZ61_15300   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EXZ61_15300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  QDL55427 UniProt:  A0A515ERX6 LinkDB All DBs Position complement(3321336..3321575) Genome browser AA seq 79 aa AA seqDB search MSDIEVRVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKINTVQNAIDYANTHKKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagtccgcgtcaaaaaaatcattgccgagcaactcggtgttgaagag tctcaagtcaccaatgagaaagccttcgtggctgatctgggtgctgactctttggatacc gttgaacttgtgatggccttggaagatgagttcggaattgaaattccagacgaagacgct gaaaagatcaacacggttcagaacgcgattgattacgcgaatacccacaagaaggcctaa

DBGET integrated database retrieval system