Rheinheimera sp. D18: E0Z06_08130 Help Entry E0Z06_08130       CDS       T05923                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhh  Rheinheimera sp. D18 Pathway rhh01100   Metabolic pathways rhh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E0Z06_08130    00074 Mycolic acid biosynthesis     E0Z06_08130   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E0Z06_08130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 HLH Motif Other DBs NCBI-ProteinID:  QBL09477 UniProt:  A0A4P6VQT5 LinkDB All DBs Position complement(1718636..1718872) Genome browser AA seq 78 aa AA seqDB search MSNIEERVKKIIIEQLGVKEDEVKHEASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQSAIDYIKAHAE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgcgtaaagaaaattattatcgaacaactgggtgttaaagaa gacgaagtgaagcacgaagcgtcattcgttgaagatttaggtgccgattcattagatacc gttgaattagtaatggcgcttgaagaagaattcgatactgagattcctgacgaagaagct gaaaaaattacgactgttcagtctgctattgattatatcaaagcacacgcagagtaa

DBGET integrated database retrieval system