KEGG   Rheinheimera sp. D18: E0Z06_12945
Entry
E0Z06_12945       CDS       T05923                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
rhh  Rheinheimera sp. D18
Pathway
rhh00770  Pantothenate and CoA biosynthesis
rhh01100  Metabolic pathways
rhh01240  Biosynthesis of cofactors
Module
rhh_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:rhh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    E0Z06_12945
Enzymes [BR:rhh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     E0Z06_12945
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig Pantoate_ligase
Other DBs
NCBI-ProteinID: QBL10369
LinkDB
Position
2736484..2736966
AA seq 160 aa
MKIKAIYPGTFDPLTNGHADLVQRAARMFDSVIVGVAANPSKQPLFSLQERVALAQRAFA
GIDNVSVIGFSGLLAKFAEDQHAAVLIRGVRAVADFEYEFQLASMNRQLNPALDSIFMTP
SEKNSFISSTLVKEVCRHGGDVSSFVPADVELALKAKFKL
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaaaattaaagccatttacccaggcactttcgaccctcttactaacggtcacgccgat
ttagtgcagcgcgcagcccgaatgtttgacagtgttattgtcggcgttgcagctaaccca
agcaagcaacccttgtttagcctgcaagaacgggttgctttagcacaacgggcttttgcc
ggcattgataatgttagcgtaataggtttttcgggtttattggctaagtttgcagaagat
cagcatgcggcggtgttaattcgcggcgtgcgcgccgttgccgattttgaatacgagttt
caattagccagtatgaaccgacagttgaacccagcgttagatagtatttttatgacaccg
tcggaaaaaaactcatttatctcatcgactctagtcaaagaggtatgtcggcacggtggt
gacgtgtccagctttgttcccgccgatgttgaactagccctaaaagccaaatttaaatta
tga

DBGET integrated database retrieval system