KEGG   Sinorhizobium fredii NGR234: NGR_c34890
Entry
NGR_c34890        CDS       T00888                                 
Symbol
gpmA
Name
(GenBank) phosphoglycerate mutase 1 family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00010  Glycolysis / Gluconeogenesis
rhi00260  Glycine, serine and threonine metabolism
rhi00680  Methane metabolism
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
rhi01200  Carbon metabolism
rhi01230  Biosynthesis of amino acids
Module
rhi_M00002  Glycolysis, core module involving three-carbon compounds
rhi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGR_c34890 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    NGR_c34890 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NGR_c34890 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rhi04131]
    NGR_c34890 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rhi04147]
    NGR_c34890 (gpmA)
Enzymes [BR:rhi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NGR_c34890 (gpmA)
Membrane trafficking [BR:rhi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NGR_c34890 (gpmA)
Exosome [BR:rhi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NGR_c34890 (gpmA)
  Exosomal proteins of melanoma cells
   NGR_c34890 (gpmA)
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-ProteinID: ACP27213
UniProt: C3MBY8
LinkDB
Position
3699256..3699891
AA seq 211 aa
MSGTLVLVRHGQSEWNLKNLFTGWRDPDLTELGVEEAKAGGAALAEYGIKFDIAFTSVLV
RAQRTCQMVLDAVGQSSLETICDQALNERDYGDLSGLNKDDARAKWGEEQVHIWRRSYDV
PPPGGESLRDTGARVWPYYLTEILPRVLAGEKVLVAAHGNSLRSLVMVLDRLTKEQVLNL
NLATGVPMVYKLKADSTVASKEVLGDMSAAH
NT seq 636 nt   +upstreamnt  +downstreamnt
atgagcggcactctcgtcctcgtccggcacggccagagcgaatggaacctgaagaacctg
ttcaccggctggcgcgatccggacctgaccgaactcggcgtcgaggaggcgaaggccggc
ggcgcggcgcttgccgaatacggcatcaagttcgatatcgccttcacctcggtgctcgtc
cgcgcccaacgcacctgccagatggtgctcgatgccgtcggccagtcctcgctcgaaaca
atctgcgaccaggctctcaacgagcgcgactatggcgatctttccggcctcaacaaggac
gatgcccgcgccaaatggggcgaggagcaggtccatatctggcgccgctcctatgacgtg
ccgccgcccggcggcgagagcctgcgcgacaccggcgcccgcgtctggccctattacctg
accgaaatcctgccgcgtgtgctggccggtgagaaggtgctggtcgccgcccacggcaac
tcgctgcgctcgctggtgatggtgctcgatcgcctgaccaaggagcaggtcctgaacctc
aacctggccaccggcgtgccgatggtctacaagctcaaggcggattccaccgtcgcttcc
aaggaagtgctcggcgacatgtcggccgcgcattga

DBGET integrated database retrieval system