Rhizobium sp. ACO-34A: ACO34A_08120 Help Entry ACO34A_08120      CDS       T11040                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhia  Rhizobium sp. ACO-34A Pathway rhia01100   Metabolic pathways rhia01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhia00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACO34A_08120    00074 Mycolic acid biosynthesis     ACO34A_08120   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACO34A_08120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Delta_lysin Motif Other DBs NCBI-ProteinID:  ATN33774 LinkDB All DBs Position 1682367..1682603 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVVDHLGVDAEKVVEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgttaagaaaattgttgttgatcatctcggcgtagacgct gaaaaggttgttgaaggcgcgagcttcatcgacgatctgggcgcggactcgctcgatacc gttgaactggtcatggccttcgaagaagaattcggcgtcgagatcccggacgatgccgct gactcgatcctgaccgtcggtgacgcggtcaagttcatcgagaaggcccagtcctga

DBGET integrated database retrieval system