Rhizobium sp. ACO-34A: ACO34A_16370
Help
Entry
ACO34A_16370 CDS
T11040
Name
(GenBank) alkane 1-monooxygenase
Organism
rhia Rhizobium sp. ACO-34A
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Bac_luciferase
DUF7388
Motif
Other DBs
NCBI-ProteinID:
ATN35379
LinkDB
All DBs
Position
complement(3394250..3395251)
Genome browser
AA seq
333 aa
AA seq
DB search
MIPFSILDLSPIAEGHSVTEALDASRRMAQKAEELGFNRFWLAEHHGMPGIASAATSIVI
AHVGAATKRVRIGSGGIMLPNHSPLVIAEQFGTLAALFPDRVDLGLGRAPGTDMRTARAL
RRNLDAGAESFPHDIIELQRLLGDPEDDQVLLAVPGARSHVPIWLLGSSLYSAHLAAALG
LPYAFASHFAPDSLLEAIAIYRERFQPSADLDKPYVMVGVMGVGAESDEEAQYLFTSSQQ
QFVNLRRNVRRPFPRPVESMDGLWTDMERIGVEHTLSYAVVGSQKTVEKKLEDFLDETGA
DELIVSMPIHDIDARLRSVEIFGGVMQKVPENS
NT seq
1002 nt
NT seq
+upstream
nt +downstream
nt
atgatacccttttcgatcctcgacctgtcaccgatcgccgagggacatagcgtgacggag
gcgctggatgcgtcccgccggatggcccagaaggcggaggaactcgggttcaaccgtttc
tggctcgccgagcatcatggcatgccgggaatcgccagtgcggcgacctccatcgtgatc
gcccatgtgggggctgcaacgaagcgcgtccgcatcggctccggcggcatcatgctgccg
aaccattcgccgttggtgatcgcggagcagttcggcacgcttgcggccctgttccccgat
cgcgttgatctcggtcttggccgcgcgccgggaaccgacatgcgcacggcgcgggcgctt
cgccgcaatctggacgccggggcggagagcttcccgcacgatatcatcgagttgcagcgc
ctcctcggcgacccggaggacgaccaggtgctgctggcggtgccgggtgcgcgcagccat
gtgccgatctggctgctgggttccagtctttacagtgctcatctcgctgcggctctcggg
cttccttatgccttcgcttcccatttcgctcccgattccttgttggaggccatcgccatc
tatcgcgagcggttccagccttcggccgatctcgacaagccctatgtgatggtcggcgtc
atgggggtcggagctgagagcgatgaagaggcgcaatatctcttcacctcttcgcagcag
cagttcgtcaatctgcggcgcaatgtccggcgtcctttcccgcgtccggtggagagcatg
gacgggttgtggaccgatatggagcgcatcggcgtggagcacacgctgagctatgccgtg
gtcggctcgcagaagactgtcgaaaagaagctcgaggactttctcgatgagaccggagcg
gacgaactcatcgtttccatgcccatccatgacatcgatgcgcggttgcgctctgtcgag
attttcggcggcgtcatgcagaaagtcccggaaaacagctga
DBGET
integrated database retrieval system