Rhizobium sp. AB2/73: I8E17_04205 Help Entry I8E17_04205       CDS       T10377                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhib  Rhizobium sp. AB2/73 Pathway rhib00998   Biosynthesis of various antibiotics rhib01100   Metabolic pathways rhib01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhib00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I8E17_04205    00074 Mycolic acid biosynthesis     I8E17_04205   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I8E17_04205 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Delta_lysin Motif Other DBs NCBI-ProteinID:  UEQ81734 LinkDB All DBs Position 829371..829607 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVVDHLGVDADKVVESASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgttgttgatcatcttggcgttgacgcc gacaaggttgttgaaagcgcaagcttcatcgacgatctgggtgcggactcgctcgacacc gtcgaactggtcatggccttcgaagaagaattcggcgttgaaattccggacgacgctgcc gactcgatcctgacggtcggcgacgcggtaaagttcattgagaaggctcaggcctaa

DBGET integrated database retrieval system