Rhizobium sp. AB2/73: I8E17_32625 Help Entry I8E17_32625       CDS       T10377                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism rhib  Rhizobium sp. AB2/73 Brite KEGG Orthology (KO) [BR:rhib00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rhib03032]     I8E17_32625    03036 Chromosome and associated proteins [BR:rhib03036]     I8E17_32625    03400 DNA repair and recombination proteins [BR:rhib03400]     I8E17_32625 DNA replication proteins [BR:rhib03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     I8E17_32625 Chromosome and associated proteins [BR:rhib03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     I8E17_32625 DNA repair and recombination proteins [BR:rhib03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       I8E17_32625 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG SSPI Motif Other DBs NCBI-ProteinID:  UEQ85252 LinkDB All DBs Position pAtAB2-73d:377397..377675 Genome browser AA seq 92 aa AA seqDB search MTTTNEIADKIAAEHSLTKVLAKSIVEAVIASITDAAVAGNETSLPGFGKFKVKHTPERE ARNPGTGATIKVAAAKKLAFTPAKALKDALNK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaccacaaccaacgaaattgccgacaagatcgcggcagaacacagccttaccaaggtg ctggccaagtcaatcgtcgaggcggtgatcgcttcgatcacggatgctgccgttgccggc aacgaaactagcctacccggcttcggaaaattcaaggtcaagcacacgccggagcgtgag gcgcgcaacccgggtaccggtgcaacgatcaaggttgccgcggccaagaagctggccttt acgccggcgaaggcactgaaggatgcgctgaacaagtaa

DBGET integrated database retrieval system