Rhizobium sp. Pop5: NE852_07305 Help Entry NE852_07305       CDS       T11439                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhip  Rhizobium sp. Pop5 Pathway rhip01100   Metabolic pathways rhip01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhip00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NE852_07305    00074 Mycolic acid biosynthesis     NE852_07305   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NE852_07305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  UVD58001 LinkDB All DBs Position 1052141..1052377 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVESASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgttattgatcatcttggcgtcgatgcc gacaaggtcgtcgagagcgccagctttatcgacgatctgggcgctgactcgctcgacacg gtcgaacttgtcatggctttcgaagaagaattcggcgtcgaaattcctgacgacgctgcc gactcgatcctgacggtcggagatgccgtgaagtttatcgagaaggcccaggcctga

DBGET integrated database retrieval system