Rhizobium sp. SRDI969: N2A41_06610 Help Entry N2A41_06610       CDS       T11552                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhis  Rhizobium sp. SRDI969 Pathway rhis01100   Metabolic pathways rhis01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhis00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     N2A41_06610    00074 Mycolic acid biosynthesis     N2A41_06610   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     N2A41_06610 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Delta_lysin Motif Other DBs NCBI-ProteinID:  UWM82926 LinkDB All DBs Position 1304518..1304754 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVESASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgttattgatcatcttggcgtcgatgcc gacaaggtcgtcgagagcgccagctttatcgacgatctgggcgccgactcgctcgacacg gtcgaacttgtcatggctttcgaagaagaattcggcgttgaaattcctgacgacgctgcc gactcgatcctgacggttggcgatgccgtgaagttcattgagaaggcccaggcctga

DBGET integrated database retrieval system