Rhizobium sp. Y9: BLX90_03745 Help Entry BLX90_03745       CDS       T11041                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhiy  Rhizobium sp. Y9 Pathway rhiy01100   Metabolic pathways rhiy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhiy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BLX90_03745    00074 Mycolic acid biosynthesis     BLX90_03745   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BLX90_03745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Delta_lysin Motif Other DBs NCBI-ProteinID:  AUC11132 LinkDB All DBs Position 1:765492..765728 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgtaattgatcatcttggcgttgacgcc gacaaggttgttgaaggcgccagcttcattgacgatctgggcgctgattcgctcgatacc gttgaactggtcatggctttcgaagaagaatttggcgttgaaattcccgacgacgctgcg gattcgatcctgaccgtcggcgacgctgtcaagttcatcgagaaggcccaggcctga

DBGET integrated database retrieval system