Rhizobium sp. BT03: QMO80_006541 Help Entry QMO80_006541      CDS       T09950                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism rhiz  Rhizobium sp. BT03 Brite KEGG Orthology (KO) [BR:rhiz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rhiz03032]     QMO80_006541    03036 Chromosome and associated proteins [BR:rhiz03036]     QMO80_006541    03400 DNA repair and recombination proteins [BR:rhiz03400]     QMO80_006541 DNA replication proteins [BR:rhiz03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     QMO80_006541 Chromosome and associated proteins [BR:rhiz03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     QMO80_006541 DNA repair and recombination proteins [BR:rhiz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       QMO80_006541 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  WHO77317 LinkDB All DBs Position pRspBT03a:59151..59429 Genome browser AA seq 92 aa AA seqDB search MTTTNEIADKIAADHGLTKAQSKTIVEAVFAAITTAATSGAETSIPSFGKFKVKATPERD ARNPATGAMIKVAAAKKLTFQPAKALKDAMNT NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaccaccaccaatgaaatcgcagacaaaatcgcagctgaccatggcctgacgaaggcg caaagcaaaacgatcgtcgaggccgtgttcgccgcaatcacgaccgccgccacatccggc gccgagacgtcgatcccttcgttcgggaagttcaaggtgaaggcaacgcccgagcgcgat gcgcgcaatccggctacaggcgcaatgatcaaggtggcagctgcgaagaagctgacgttc cagcctgccaaggcgctcaaggatgcgatgaacacgtaa

DBGET integrated database retrieval system