Rhizobium sp. Kim5: Kim5_CH01578 Help Entry Kim5_CH01578      CDS       T05501                                  Symbol acpP Name (GenBank) acyl carrier protein AcpP   KO K02078   acyl carrier protein Organism rhk  Rhizobium sp. Kim5 Pathway rhk01100   Metabolic pathways rhk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Kim5_CH01578 (acpP)    00074 Mycolic acid biosynthesis     Kim5_CH01578 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Kim5_CH01578 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  ARQ57671 LinkDB All DBs Position 1587392..1587628 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVESASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgttattgatcatcttggcgtcgatgcc gacaaggtcgtcgagagcgccagctttatcgacgatctgggcgccgactcgctcgacacg gtcgaacttgtcatggctttcgaagaagaattcggcgttgaaatccccgacgacgcagct gactcgatcctgacggtcggcgatgcagtgaagttcattgagaaggcccaggcctga

DBGET integrated database retrieval system