KEGG   Rhodovulum sp. MB263: B5V46_08445
Entry
B5V46_08445       CDS       T04771                                 
Name
(GenBank) metalloprotease TldD
  KO
K03568  TldD protein
Organism
rhm  Rhodovulum sp. MB263
Brite
KEGG Orthology (KO) [BR:rhm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rhm01002]
    B5V46_08445
Peptidases and inhibitors [BR:rhm01002]
 Peptidases of unknown catalytic type
  Family U62
   B5V46_08445
SSDB
Motif
Pfam: PmbA_TldD_3rd PmbA_TldD_2nd PmbA_TldD_1st
Other DBs
NCBI-ProteinID: ARC88643
LinkDB
Position
complement(1799355..1800776)
AA seq 473 aa
MQHPPFRPFETALDRDRALLLLQAATLGAEDGELFLERRRSEMLSFDDGRLRTASYDATE
GFGLRAVRGEASGYAHSSDISEAALKRAVETARLAVAEGGGTLALGPQPTNRRLYSDADP
LAEAPFALKIETLREIDDFARALDPRVVQVTATLAASLQEVVILRPDGTLLSDIRPMTRL
NVSVIVEENGHRESGSHGGGGRTGLAGRIDRAGWEASAREALRIALVNLEAEPAPAGMMD
VVLGPGWPGILLHEAVGHGLEGDFNRKGSSAFAGLMGQQVAARGVTVIDDGTIPDRRGSI
SFDDEGTPSNRTVLIEDGVLVGYMQDRQNARLMGLAPTGNGRRESHAHPPMPRMTNTCML
GGDTDPADILAGLKDGIYAVGFGGGQVDITNGKFVFSCTEAYRVRNGKVGAPVKGATLIG
DGPAAMKQIRAIGNDMALDPGIGNCGKAGQWVPVGVGQPTLLIGGLTVGGAAA
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgcaacaccccccgttccgcccattcgagaccgcactcgaccgcgaccgggcgctgctg
ctgttgcaggccgccacgctgggcgccgaggatggcgagttgtttctcgagcggcgccgc
tcggaaatgctgagcttcgatgacggccggctcaggacggcaagctacgatgccactgaa
ggattcggcctgcgcgcggtgcgcggcgaggcctcgggctatgcccattcaagcgacatc
tcggaagcggcgctgaaacgcgcggtcgagaccgcccggcttgccgtggccgagggcggc
ggcacgcttgcgctgggaccgcagcccaccaaccggcggctctatagcgatgccgacccg
ctggccgaggcgcccttcgcgctcaagatcgagacgctccgcgaaatcgacgatttcgcc
cgggcgctcgacccccgcgtggtgcaggtgaccgccacgctcgcagcctcgctgcaggag
gtggtcatcctgcgccctgacggcacgcttctttccgacatccggccgatgacccggctc
aatgtctcggtgatcgtcgaggagaacgggcatcgcgaatcgggcagccatggcggcggc
ggccgcaccgggctggccgggcggatcgaccgggccggctgggaggcctcggcgcgcgag
gcgctgcgcatcgcgctggtcaatctcgaggccgagcccgcgcctgccggaatgatggat
gtggtgctggggccgggctggcccggcatcctgctgcatgaggcggtgggccacgggctc
gagggcgatttcaaccgcaagggcagctcggcctttgccgggctgatggggcagcaggtg
gcggccaggggcgtgaccgtgatcgacgacggcaccattcccgaccggcgcggctcgatc
agtttcgatgacgagggcacgccctcgaaccgcaccgtgctgatcgaggatggcgtgctt
gtcggctacatgcaggaccgccagaacgcacggctgatggggctcgcgcccaccggcaac
ggccggcgcgaaagccatgcccatccgccgatgccgcggatgaccaatacctgcatgctg
ggcggcgacaccgatcctgccgacatactggccgggctgaaggacgggatctatgcggta
ggcttcggcggcgggcaggtcgacatcaccaatggcaagttcgtcttcagctgcaccgag
gcctaccgggtgaggaacggcaaggtcggggccccggtcaagggcgccacgctgatcggc
gacggcccggccgcgatgaagcagatacgcgccatcggcaatgacatggcgctggatccc
gggatcggcaattgcggcaaggcagggcaatgggttccggtgggcgtgggccagccgacg
ctgctgatcggcgggctgacggtggggggcgccgcggcctga

DBGET integrated database retrieval system