Rhodoferax sp. AJA081-3: HZ993_05110 Help Entry HZ993_05110       CDS       T08330                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhoa  Rhodoferax sp. AJA081-3 Pathway rhoa01100   Metabolic pathways rhoa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhoa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HZ993_05110    00074 Mycolic acid biosynthesis     HZ993_05110   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HZ993_05110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QTN29216 UniProt:  A0A975I2D9 LinkDB All DBs Position complement(1093334..1093594) Genome browser AA seq 86 aa AA seqDB search MQALEQEITALVIESLNLEDVSPTDIDPDAALFVDGLGLDSIDALELGLALQKRYGVAMS GDAQETRRHFSSVRALAAFVDAARTK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcaggcacttgaacaagaaattactgcgctcgtcattgagtcattgaacttggaagat gtcagtcccaccgatattgacccagacgccgcgttgttcgtcgatggattaggtctggac tctatcgatgcgctggagcttggtttggctcttcaaaagcgttatggcgtggctatgtcc ggcgatgcccaggaaacgcggcgtcacttttccagcgtgcgcgcgttggcagcatttgtt gacgctgccagaaccaagtaa

DBGET integrated database retrieval system