Fontisubflavum oceani: QTA57_11680 Help Entry QTA57_11680       CDS       T09173                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhoc  Fontisubflavum oceani Pathway rhoc01100   Metabolic pathways rhoc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhoc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QTA57_11680    00074 Mycolic acid biosynthesis     QTA57_11680   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QTA57_11680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  WJY20508 LinkDB All DBs Position 2282656..2282889 Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLSVEEDKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFIKEAQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgcagatcgcgtgaagaaaatcgtcgtcgagcacctgagtgtggaagag gataaagtgaccgagaatgcgtcgttcatcgacgatctgggcgcagattcgctcgacacc gttgagttggtgatggcgtttgaagaagagttcggtatcgagatccccgatgatgcggcg gaaacgatccagactttcggcgatgcggtgaaattcatcaaagaagctcagtaa

DBGET integrated database retrieval system