Fontisubflavum oceani: QTA57_13240 Help Entry QTA57_13240       CDS       T09173                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhoc  Fontisubflavum oceani Pathway rhoc01100   Metabolic pathways rhoc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhoc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QTA57_13240    00074 Mycolic acid biosynthesis     QTA57_13240   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QTA57_13240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  WJY20776 LinkDB All DBs Position 2590669..2590932 Genome browser AA seq 87 aa AA seqDB search MADSVQDQVIAIIAEQAVLEPGDVALDNSLEDLGIDSLGLVESIFAIEEAFDIQVPFNAN EPDQSDFDISSVAAIVKAVEGLVADQK NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggccgatagcgttcaagaccaagtgatcgcgattattgcggaacaggctgtgttggag cctggcgatgttgctctcgataactcactcgaagacctgggtattgatagcctcggcctg gtcgagtcgatctttgcgatagaagaagccttcgatattcaggtgccgttcaatgccaat gagccggatcagagcgatttcgatatttcgagtgtcgcggcaattgtgaaggctgttgag gggctggtggccgaccaaaaatga

DBGET integrated database retrieval system