Rhodococcus sp. 008: AOT96_16765 Help Entry AOT96_16765       CDS       T05462                                  Name (GenBank) preprotein translocase   KO K03116   sec-independent protein translocase protein TatA Organism rhod  Rhodococcus sp. 008 Pathway rhod03060   Protein export rhod03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:rhod00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AOT96_16765  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     AOT96_16765  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:rhod02044]     AOT96_16765 Secretion system [BR:rhod02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    AOT96_16765 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ANQ72318 LinkDB All DBs Position 3604975..3605151 Genome browser AA seq 58 aa AA seqDB search MGALSPTHWAIVAVVLVVLFGSKKLPDAARGLGRSMRILKSEVGELQSDTDLALEQRD NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atgggcgcgctcagcccgactcactgggcgatcgtcgcagtagtgctcgtggtgctgttc ggttcgaagaagctgcccgacgcggcccggggcctcggcaggtcgatgcggatcctgaag tccgaagtcggtgaactgcagtcggatacggacctcgcgttggagcagcgagactga

DBGET integrated database retrieval system