Rhodopseudomonas sp. P1: LRC39_08120
Help
Entry
LRC39_08120 CDS
T11217
Name
(GenBank) response regulator
KO
K03413
two-component system, chemotaxis family, chemotaxis protein CheY
Organism
rhoe Rhodopseudomonas sp. P1
Pathway
rhoe02020
Two-component system
rhoe02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
rhoe00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
LRC39_08120
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
LRC39_08120
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
rhoe02022
]
LRC39_08120
02035 Bacterial motility proteins [BR:
rhoe02035
]
LRC39_08120
Two-component system [BR:
rhoe02022
]
CheA family
CheA-CheYBV (chemotaxis)
LRC39_08120
Bacterial motility proteins [BR:
rhoe02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
LRC39_08120
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Motif
Other DBs
NCBI-ProteinID:
XAT74925
LinkDB
All DBs
Position
1739271..1739636
Genome browser
AA seq
121 aa
AA seq
DB search
MKTCLVVDDSSVIRKVARRILEGLDFEIVEAEDGEKALEACKHGLPDAVLLDWNMPVMDG
YEFLRNLRRMPGGDAPKVVFCTTENDVAHIARALHAGANEYIMKPFDKDIVTAKFQEVGL
I
NT seq
366 nt
NT seq
+upstream
nt +downstream
nt
atgaagacatgtctggtggtcgacgactcgagcgtcatccggaaggtcgcgcggcgcatc
ctcgaaggtctcgacttcgagatcgtcgaagctgaagacggcgagaaggcgctcgaagcc
tgcaagcacgggctgcccgacgccgttctgctcgattggaacatgccggtgatggatggc
tacgagtttctgcgcaacctgcgccggatgcccggtggcgacgcgccgaaggtggtgttc
tgcaccaccgagaacgacgtcgcgcacatcgcgcgggcgctgcatgccggcgccaacgaa
tacatcatgaagccgttcgacaaggacatcgtcacggcgaagtttcaggaagtcggcctg
atctga
DBGET
integrated database retrieval system