Rhodoferax sp. WC2427: AB3G31_04450 Help Entry AB3G31_04450      CDS       T10716                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhof  Rhodoferax sp. WC2427 Pathway rhof01100   Metabolic pathways rhof01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhof00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AB3G31_04450 (acpP)    00074 Mycolic acid biosynthesis     AB3G31_04450 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AB3G31_04450 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  XDC19875 LinkDB All DBs Position 919630..919869 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEEAQVTNEKSFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYATSHPKG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgcgttaaaaaaatcattgccgaacaactgggtgtggaagaa gcccaagttaccaacgaaaagtcattcgtggccgatctgggcgctgactcgttggacacc gtcgaactggtgatggcactggaagatgagtttggcatcgaaatcccggacgaagacgcc gagaagatcaccaccgtgcaaaacgcgatcgactacgcgaccagccaccccaagggctaa

DBGET integrated database retrieval system