Rhodoferax sp. WC2427: AB3G31_07360 Help Entry AB3G31_07360      CDS       T10716                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhof  Rhodoferax sp. WC2427 Pathway rhof01100   Metabolic pathways rhof01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhof00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AB3G31_07360    00074 Mycolic acid biosynthesis     AB3G31_07360   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AB3G31_07360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  XDC20430 LinkDB All DBs Position 1535380..1535622 Genome browser AA seq 80 aa AA seqDB search MELESIYAKLTAIFHDVFDDESIKVTPELTADDVDEWDSLAHIRLVLAIEKKFGLKFSAA EVGRLKNVGEFVALIQSKAQ NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggaactcgaatcaatttacgcaaagctcaccgctatttttcacgatgtgttcgacgat gaaagcatcaaagtcacgcccgagctcaccgccgatgatgtcgacgaatgggacagcctg gcccacattcggctggttttagccatcgagaaaaaattcggcctgaagttctcggccgcc gaagtgggccgcctcaagaacgtcggtgaatttgtagctttgatccaatccaaggcgcaa tga

DBGET integrated database retrieval system