Rhodococcus sp. JVH1: JVH1_29965 Help Entry JVH1_29965        CDS       T10360                                  Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism rhoj  Rhodococcus sp. JVH1 Pathway rhoj00190   Oxidative phosphorylation rhoj01100   Metabolic pathways Module rhoj_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:rhoj00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     JVH1_29965  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:rhoj00194]     JVH1_29965 Photosynthesis proteins [BR:rhoj00194]  Photosystem and electron transport system   F-type ATPase [OT]    JVH1_29965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF7521 Motif Other DBs NCBI-ProteinID:  XEM92312 LinkDB All DBs Position 1:6446981..6447226 Genome browser AA seq 81 aa AA seqDB search MSLAYLAQEAVQETNSTGFGAIGYGLAAIGPGIGVGIVVGKAIEGMVRQPEMAGQVRTTM FLGIAFTEALALIGLVAGFIF NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagcctcgcctacctcgctcaggaagctgtccaggaaaccaactcgacgggtttcgga gccatcggctacggcctcgccgcgatcggccccggcatcggcgtgggcatcgtcgtcggt aaggcgatcgagggaatggttcgccagcccgagatggccggacaggttcgtaccacgatg ttcctcggtatcgccttcaccgaagccctcgcgctgatcggcctcgtcgccggcttcatt ttctaa

DBGET integrated database retrieval system