Rhodoluna sp. KAS3: RKAS3_05500
Help
Entry
RKAS3_05500 CDS
T09960
Name
(GenBank) 3'-5' exonuclease
KO
K02342
DNA polymerase III subunit epsilon [EC:
2.7.7.7
]
Organism
rhok
Rhodoluna sp. KAS3
Pathway
rhok03030
DNA replication
rhok03430
Mismatch repair
rhok03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
rhok00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
RKAS3_05500
03430 Mismatch repair
RKAS3_05500
03440 Homologous recombination
RKAS3_05500
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
rhok03032
]
RKAS3_05500
03400 DNA repair and recombination proteins [BR:
rhok03400
]
RKAS3_05500
Enzymes [BR:
rhok01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.7 DNA-directed DNA polymerase
RKAS3_05500
DNA replication proteins [BR:
rhok03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
DNA polymerase III holoenzyme
RKAS3_05500
DNA repair and recombination proteins [BR:
rhok03400
]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
DNA polymerase III holoenzyme
RKAS3_05500
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
RNase_T
Rv2179c-like
Motif
Other DBs
NCBI-ProteinID:
BDS48973
LinkDB
All DBs
Position
556043..556774
Genome browser
AA seq
243 aa
AA seq
DB search
MTDQQLSFDFSPDLPDWARQIAVFDLETTGLDLTDARIVTACAVELDEHGSVVGQNVEWL
ADPGIEIPTPASDVHGVTTEMARRDGREASEVVSEILATLKGFFARGLPVVAYNAPYDFT
ILHYEAIRHGLEPLKIGSIIDPLVIDRFKDKYRKGKRRLENAAEFYQVELADAHNATADA
IAAGRVAQAIAKRWADELPASLPDLHAAQIQWSDFLDSDFENYMRRSVNPDFSVKRGWPL
KLN
NT seq
732 nt
NT seq
+upstream
nt +downstream
nt
gtgaccgaccaacaactttcgtttgacttctcccctgacctgcctgattgggctaggcaa
attgccgttttcgatcttgaaaccacaggtctagatctaaccgatgcccgaattgtcacc
gcctgtgcggttgagcttgacgagcatggttctgtggttgggcaaaacgtcgaatggctg
gccgatccaggcatcgagattcctacacctgccagcgacgttcacggtgtcaccaccgaa
atggccagacgagacggcagggaggccagtgaggtggtttccgaaatcctggccaccctc
aagggttttttcgctagagggctcccagtagttgcctataacgcaccatacgactttacg
attttgcattacgaggccattcggcacggcctagaacctttgaaaatcggttcaattatt
gatcccctggtcattgaccggttcaaggacaaatatcgcaaaggaaagcgccgcttggag
aacgctgccgagttctaccaagttgaactcgccgatgcccacaacgctacggccgacgca
atcgcagccggacgtgtggcccaggctatcgctaagcggtgggccgatgaactgccagcc
tcactcccagatcttcatgccgcgcaaattcaatggagtgatttcctcgacagcgacttt
gaaaattacatgcgccggagtgtcaaccctgactttagtgtcaagcgtggctggccacta
aagctgaattag
DBGET
integrated database retrieval system