Rhodoluna sp. KAS3: RKAS3_07010 Help Entry RKAS3_07010       CDS       T09960                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhok  Rhodoluna sp. KAS3 Pathway rhok01100   Metabolic pathways rhok01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhok00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RKAS3_07010 (acpP)    00074 Mycolic acid biosynthesis     RKAS3_07010 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RKAS3_07010 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BDS49124 LinkDB All DBs Position 722931..723176 Genome browser AA seq 81 aa AA seqDB search MALSQSEVLAGLAEIVNEETGIATEAVQLEKSFTDDLDIDSISMMTIVVNAEDKFGVKIP DEEVKNLITVGDAVNFIVSAQ NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcactttcacagagcgaagtacttgccggtcttgcagagatcgttaacgaagagacc ggtattgctaccgaggctgttcagctagagaagtcattcaccgacgacctagacatcgac tcaatctcaatgatgaccatcgttgttaacgctgaagacaagttcggcgtaaagatccct gacgaagaggttaagaacctaatcaccgttggtgacgcagttaacttcatcgtttcagct cagtaa

DBGET integrated database retrieval system