Rhodococcus sp. P1Y: D8W71_02235 Help Entry D8W71_02235       CDS       T09477                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhop  Rhodococcus sp. P1Y Pathway rhop01100   Metabolic pathways rhop01110   Biosynthesis of secondary metabolites Module rhop_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) Brite KEGG Orthology (KO) [BR:rhop00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D8W71_02235    00074 Mycolic acid biosynthesis     D8W71_02235   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D8W71_02235 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AYJ47361 LinkDB All DBs Position complement(471865..472134) Genome browser AA seq 89 aa AA seqDB search MNSPTPSHDRREQIADLLARVGHISKGQIEDATRLTADAGLDSVDLIELTNALETTFAIE LTEADTADITTVHDVVTMVATAMERSRAR NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaactcacccacgccgagtcacgatcgccgtgagcagatcgctgatttgctggcccgg gtaggtcacatatcgaagggtcagatcgaggacgccacccgtttgaccgctgatgccggg ctcgactcggtcgacctgattgagctaacgaacgccttagagacaacattcgcgatcgag ttgaccgaggcggacacggccgacatcactaccgtgcacgacgtggtgaccatggtggcg acggctatggagcggagccgagcgaggtga

DBGET integrated database retrieval system