Rhodopseudomonas sp. P2A-2r: ONR75_20280 Help Entry ONR75_20280       CDS       T10299                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhor  Rhodopseudomonas sp. P2A-2r Pathway rhor01100   Metabolic pathways rhor01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhor00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ONR75_20280    00074 Mycolic acid biosynthesis     ONR75_20280   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ONR75_20280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  UZE47291 LinkDB All DBs Position complement(4187058..4187297) Genome browser AA seq 79 aa AA seqDB search MSEIGERVKKIVVEHLGVEPEKVVDAASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgagattggcgagcgagttaagaagatcgtggtcgaacaccttggtgttgaaccc gaaaaagtagtcgatgccgcgagcttcatcgatgatctcggtgcagacagcctcgacact gtcgagctcgtgatggcattcgaagaagagttcggctgcgaaattcccgatgacgccgct gagacgatcctcaccgtcggcgacgccaccaagtttcttgaaaagaacgcgaagagctaa

DBGET integrated database retrieval system