Rhodococcus sp. WB1: A4U64_14750 Help Entry A4U64_14750       CDS       T10270                                  Name (GenBank) preprotein translocase   KO K03116   sec-independent protein translocase protein TatA Organism rhow  Rhodococcus sp. WB1 Pathway rhow03060   Protein export rhow03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:rhow00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     A4U64_14750  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     A4U64_14750  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:rhow02044]     A4U64_14750 Secretion system [BR:rhow02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    A4U64_14750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ANZ25789 LinkDB All DBs Position complement(3326134..3326307) Genome browser AA seq 57 aa AA seqDB search MGALSPAHWAIIALVVLVLFGSKRLPEAARGLGRSMRILKTEVGELHTDTGDAPREL NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atgggagcactcagtcccgcccactgggcgatcattgctctcgtggtgctggtgttgttc ggatccaagcggctgcccgaggccgcacggggcctcggacggtcgatgcgaatcctgaag acggaagtgggtgagttgcatacggacaccggcgacgcgccacgggagctgtga

DBGET integrated database retrieval system