Rhodococcus sp. WB1: A4U64_23360 Help Entry A4U64_23360       CDS       T10270                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism rhow  Rhodococcus sp. WB1 Pathway rhow01100   Metabolic pathways rhow01110   Biosynthesis of secondary metabolites Module rhow_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) Brite KEGG Orthology (KO) [BR:rhow00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A4U64_23360    00074 Mycolic acid biosynthesis     A4U64_23360   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A4U64_23360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Vg_Tdu Motif Other DBs NCBI-ProteinID:  ANZ27284 LinkDB All DBs Position complement(5215144..5215395) Genome browser AA seq 83 aa AA seqDB search MTLSYRDIAAVVDEHFPEFSGPIDEHTTFDDLSCDSLVLVELGSILSARYAIDVAEEDMV AAHTFQGVADLVNRLRVDDVATA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgactctctcgtatcgtgacatcgcggccgtcgtcgacgagcactttcccgaattctcc ggccccatcgacgaacacaccaccttcgacgacctcagctgcgactccctggtgctcgtc gagctcgggtcgatcctgtccgcccggtacgcgatcgacgtcgcggaggaggacatggtg gcggcgcacacgttccagggcgtggcggacctggtcaaccgcctgcgggtggacgacgtc gcgacggcgtga

DBGET integrated database retrieval system