Rhodococcus sp. D-6: RBB84_04170 Help Entry RBB84_04170       CDS       T10622                                  Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism rhox  Rhodococcus sp. D-6 Pathway rhox00190   Oxidative phosphorylation rhox01100   Metabolic pathways Module rhox_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:rhox00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     RBB84_04170  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:rhox00194]     RBB84_04170 Photosynthesis proteins [BR:rhox00194]  Photosystem and electron transport system   F-type ATPase [OT]    RBB84_04170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  XBW05175 UniProt:  A0AAU7UZ20 LinkDB All DBs Position 873837..874085 Genome browser AA seq 82 aa AA seqDB search MSVALQAADVLAQETTISGAGAIGYGLAAIGPGIGIGIVVGKAIEGMARQPEMAGQLRTT MFLGIAFTEALALIGIVAGFIF NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagcgttgcgcttcaggcagcagacgtcctcgcccaggagaccacgatctcgggtgca ggcgccatcggctacggcctcgccgccatcggccccggcatcggcatcggcatcgtcgtc ggcaaggcgatcgagggcatggctcgtcagcccgagatggctggccagctgcgcaccacg atgttcctcggtatcgccttcaccgaggccctcgcgctgatcggcatcgtcgccggcttc atcttctga

DBGET integrated database retrieval system