Rhodocytophaga rosea: GXP67_36430 Help Entry GXP67_36430       CDS       T06412                                  Name (GenBank) hypothetical protein   KO K00177   2-oxoglutarate ferredoxin oxidoreductase subunit gamma [EC:1.2.7.3] Organism rhoz  Rhodocytophaga rosea Pathway rhoz00020   Citrate cycle (TCA cycle) rhoz00720   Other carbon fixation pathways rhoz01100   Metabolic pathways rhoz01110   Biosynthesis of secondary metabolites rhoz01120   Microbial metabolism in diverse environments rhoz01200   Carbon metabolism rhoz01210   2-Oxocarboxylic acid metabolism Module rhoz_M00009   Citrate cycle (TCA cycle, Krebs cycle) rhoz_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:rhoz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     GXP67_36430   09102 Energy metabolism    00720 Other carbon fixation pathways     GXP67_36430 Enzymes [BR:rhoz01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      GXP67_36430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  QHT71763 UniProt:  A0A6C0GW21 LinkDB All DBs Position 8912611..8912916 Genome browser AA seq 101 aa AA seqDB search MQAGKVAQQTECVLEGKISALNEKVTGLKESNALAGKLLQAVTHGIVKPQELKQAIEQVP GAEDKRQANIRSILQEAGISVKQPDIKQTRGQQRGMGGISM NT seq 306 nt NT seq  +upstreamnt  +downstreamnt gtgcaggcggggaaggtagcccagcagacggaatgcgtactagagggtaaaatatcggcc ttaaatgagaaagtaacaggtttgaaggaaagcaatgccctggccggtaaacttttacag gccgtaacccacggaatcgtaaaaccccaggagctgaaacaggccattgagcaggtaccg ggtgccgaagataaacgacaggccaatatccggagcattctgcaggaagcagggatttca gttaagcagccggatatcaaacaaacccggggacagcagcggggcatgggtggaatcagt atgtaa

DBGET integrated database retrieval system