Rhodobacter xanthinilyticus: LPB142_09485
Help
Entry
LPB142_09485 CDS
T04631
Name
(GenBank) single-stranded DNA-binding protein
KO
K03111
single-strand DNA-binding protein
Organism
rhp
Rhodobacter xanthinilyticus
Pathway
rhp03030
DNA replication
rhp03430
Mismatch repair
rhp03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
rhp00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
LPB142_09485
03430 Mismatch repair
LPB142_09485
03440 Homologous recombination
LPB142_09485
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
rhp03032
]
LPB142_09485
03400 DNA repair and recombination proteins [BR:
rhp03400
]
LPB142_09485
03029 Mitochondrial biogenesis [BR:
rhp03029
]
LPB142_09485
DNA replication proteins [BR:
rhp03032
]
Prokaryotic type
DNA Replication Initiation Factors
Initiation factors (bacterial)
LPB142_09485
DNA repair and recombination proteins [BR:
rhp03400
]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
Other MMR factors
LPB142_09485
TLS (translesion DNA synthesis) factors
Other SOS response factors
LPB142_09485
Mitochondrial biogenesis [BR:
rhp03029
]
Mitochondrial DNA transcription, translation, and replication factors
Mitochondrial DNA replication factors
Other Mitochondrial DNA replication factors
LPB142_09485
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SSB
DUF6879
Motif
Other DBs
NCBI-ProteinID:
AOZ69515
UniProt:
A0A1D9MCC0
LinkDB
All DBs
Position
1933285..1933812
Genome browser
AA seq
175 aa
AA seq
DB search
MAGSVNKVILVGNLGRDPEVRSFANGGKVCNLRIATSETWRDKASGERKERTEWHSVAIF
SEPLAKIAEQYLRKGSKVYIEGSLETRKWQDQSGQDRYTTEVVLRPFTGNLTLLDGRDGG
GSGGGGGGNYGGGASGGGYGGGYDDGPSYGGGAGGGGRSGGGGGGRPDFDDEIPF
NT seq
528 nt
NT seq
+upstream
nt +downstream
nt
atggcgggcagcgtcaacaaggtcattttggtgggcaatctggggcgcgaccccgaggtg
cgcagcttcgccaacggcggcaaggtctgcaacctgcgcatcgcgacctcggaaacttgg
cgcgacaaggcatcgggcgagcgcaaggagcgcaccgagtggcattccgtcgcgatcttc
tccgagccgctggcgaaaatcgccgagcaatatctgcgcaagggctcgaaggtctatatc
gagggcagcctcgagacccgcaaatggcaagatcaatcgggccaggaccgctacacgacc
gaggtcgtgctgcgccccttcaccggcaacctgacgctgcttgacgggcgcgatggcggc
ggctcgggcggcggcggcggcggcaattacggcggcggcgcctcgggtggcggctatggc
ggcggctatgatgacggcccgtcctatggtggcggcgcgggcggcggcggccgttcgggt
ggcggcggcggcggccggccggatttcgacgacgaaatccccttctaa
DBGET
integrated database retrieval system